Sale

FITC Beta-Amyloid (1-40), Recombinant

0 customer reviews Sold: 0

Price range: $475.00 through $750.00

Dosage

Choose an option

Dosage

0.5mg
1.0mg

Clear

Physical State: White lyophilized powder
Temperature Storage: -20°C
Temperature Shipping: Ambient
Sequence:
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Source: Recombinant. A DNA sequence encoding the human Beta-Amyloid (1-40) sequence was expressed in E. coli and had FITC molecules attached for fluorescence.
Purity: >95% by Mass Spec.
Molecular Mass: Approximately 4,330 Da to 5,108 Da

Add to cart

Product Description

Product background: Beta-Amyloid peptides (A-beta), the major constituent of amyloid plaques in the brains of Alzheimer’s patients, are thought to be a primary contributor to Alzheimer’s Disease (AD).

About the product: Expressed recombinantly in E. coli, Beta-Amyloid (1-40) is purified to our highest standards to ensure batch-to-batch consistency in both purity and quality. rPeptide’s human Beta-Amyloid has been covalently labeled with Fluorescein Isothiocyanate on the side chain of lysine residues.

Applications: This FITC labeled form of Beta-Amyloid (1-40) is ideally suited to localization experiments, aggregation monitoring and other fluorescence based studies without the need for mutations or further labeling.